PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602563.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 254aa    MW: 28434.4 Da    PI: 7.4108
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602563.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1054.6e-3351108260
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                     ++vrY+eClkNhA+ +GghavDGCg+fmp+ geegt++alkCaAC+CHRnFHR+eve e
  XP_009602563.1  51 SSVRYRECLKNHAVGIGGHAVDGCGDFMPA-GEEGTMDALKCAACNCHRNFHRKEVEGE 108
                     679**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2346109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.1E-3053105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.2E-3054105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.38355104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466897.66E-21177252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-32178253IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-25191247IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MEFDEEHEEQ EEEIGNIHQI SSAAATVNYQ TQGNNSVRGV EEGVSTTVRK SSVRYRECLK  60
NHAVGIGGHA VDGCGDFMPA GEEGTMDALK CAACNCHRNF HRKEVEGEVF HHTPPPHLTH  120
HHPQPHHSHH PQFSPYTSYR TPHHPSGYLH VTPPSHQRPL ALPSTSREDE DMSNPSSSGG  180
GGNGGVGGSS RKRFRTKFTA DQKDKMLAFA ERLGWRMQKQ DEALVQQFCA ETNVQRHVFK  240
VWMHNNKHTL GKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-261922491875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-106HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602563.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH58e-77ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLM1AZE81e-116M1AZE8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000336241e-116(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-67homeobox protein 22